PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00034112-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 368aa    MW: 41635.1 Da    PI: 5.5188
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00034112-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS1065.1e-3317932530177
              GRAS  30 laspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqG 122
                       + +   d+ + +      +L arl++s+ +l+++l++  ts    +e l+a++++    P  k+sh+++ q++l+ +e+++r+Hi+Df+i +G
  PSME_00034112-RA 179 RIARFEDSREEAREKGSDGLVARLLGSGGRLFATLSSGLTS---LAEILKAYQMYLFSIPHRKMSHFLTYQTVLNVTEKSNRLHIVDFGILYG 268
                       5555666666666677889****************999999...9************************************************ PP

              GRAS 123 lQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfe 177
                       +QWp+L+q La+R +gpp+lRiTg++ p++    +e++eet++rL  +A++l ++++
  PSME_00034112-RA 269 FQWPSLIQCLANRLGGPPMLRITGIDFPQPRfrAAERIEETRHRLVYYAKSLALTLS 325
                       *****************************9999*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098521.647116368IPR005202Transcription factor GRAS
PfamPF035141.8E-30179325IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MQYISDMLMD ESMEENKCMY QECSALQATV KPFYDILGEN YPPQRLSNSN TVGENQKPSL  60
NYYEDDVQNK IEDRSRIGEF FNSQMPRGFE SPLSANLYAA YSSQYSFSSS GSSTVIDGLI  120
GCPIYVLSLS DFLSESRHGL GGGEFEARCG EWVAFSNPKE ARNFAEWSAE KSSKCVRERI  180
ARFEDSREEA REKGSDGLVA RLLGSGGRLF ATLSSGLTSL AEILKAYQMY LFSIPHRKMS  240
HFLTYQTVLN VTEKSNRLHI VDFGILYGFQ WPSLIQCLAN RLGGPPMLRI TGIDFPQPRF  300
RAAERIEETR HRLVYYAKSL ALTLSTLGYE IECESDDPEK VKKVLEDFLG ENGVPFSHSM  360
KPKFARIL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6835671e-100DQ683567.1 Pinus radiata SCARECROW-like protein 1 (SCL1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA3E2G24e-57A3E2G2_PINRA; SCARECROW-like protein 1
TrEMBLG0ZAE82e-57G0ZAE8_PINTA; SCARECROW-like protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-35GRAS family protein